PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G015000.1
Common NamePHAVU_009G015000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family BBR-BPC
Protein Properties Length: 338aa    MW: 37424.4 Da    PI: 9.9891
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G015000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind409.93.1e-12513371301
           GAGA_bind   1 mdddgsre..rnkg.yyepa..aslkenl..glqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllal 84 
                         mdd g+re  r+k+ ++++a  + l +++   +q+m+++aerda+i+ernla+sekkaa+aerdmaflqrd+a+aern+a++erdn++++l
  Phvul.009G015000.1   1 MDDAGHREngRHKAdQFKSAqgQWLMQHQpsMKQIMAIMAERDAAIQERNLAISEKKAAYAERDMAFLQRDAAIAERNNAILERDNAFATL 91 
                         9*****9999****9***655544444432146********************************************************** PP

           GAGA_bind  85 llvensla....salpvgvqvlsgtksidslqq.lse.pqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkk 169
                         +++e+sl+     ++p+g+q+++g+k+i++ qq +++ p+++d+++++re++++++lp   aa+ ++e+ k++   rak+pke+k+++++k
  Phvul.009G015000.1  92 QYRETSLSsgsmPSCPPGCQISRGVKHIHHPQQqVHHiPNMGDPSYNTREMHTTDVLP---AAPITSEAGKSR---RAKRPKEPKSTSPNK 176
                         ******99888889*****************9955669*****************999...455555555444...778999999999999 PP

           GAGA_bind 170 ksekskkkvkkesader.............................skaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWq 231
                         k++k  kkvkkes+d +                             ska++k +dl+ln+v++Dest+P+PvCsCtG+l+qCYkWGnGGWq
  Phvul.009G015000.1 177 KTTKAAKKVKKESEDLNkvmfgkahewkngqemvnggddlnkqlavSKADWKGQDLGLNQVAYDESTMPAPVCSCTGVLKQCYKWGNGGWQ 267
                         9999999999999995559************************************************************************ PP

           GAGA_bind 232 SaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                         SaCCttt+S+yPLP+++++r+aR++grKmS++af+klL++LaaeG+dlsnpvDLkdhWAkHGtn+++ti+
  Phvul.009G015000.1 268 SACCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEGHDLSNPVDLKDHWAKHGTNRYITIK 337
                         *********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062171.1E-1071337IPR010409GAGA-binding transcriptional activator
SMARTSM012261.8E-1781337IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MDDAGHRENG RHKADQFKSA QGQWLMQHQP SMKQIMAIMA ERDAAIQERN LAISEKKAAY  60
AERDMAFLQR DAAIAERNNA ILERDNAFAT LQYRETSLSS GSMPSCPPGC QISRGVKHIH  120
HPQQQVHHIP NMGDPSYNTR EMHTTDVLPA APITSEAGKS RRAKRPKEPK STSPNKKTTK  180
AAKKVKKESE DLNKVMFGKA HEWKNGQEMV NGGDDLNKQL AVSKADWKGQ DLGLNQVAYD  240
ESTMPAPVCS CTGVLKQCYK WGNGGWQSAC CTTTLSMYPL PAVPNKRHAR VGGRKMSGSA  300
FNKLLSRLAA EGHDLSNPVD LKDHWAKHGT NRYITIK*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00540DAPTransfer from AT5G42520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007136066.10.0hypothetical protein PHAVU_009G015000g
SwissprotQ8L9991e-162BPC6_ARATH; Protein BASIC PENTACYSTEINE6
TrEMBLV7ARX60.0V7ARX6_PHAVU; Uncharacterized protein
STRINGGLYMA04G02860.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69053449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.11e-143basic pentacysteine 6